Clinical trials: Blood Platelet Disease
Immune Thrombocytopenic Purpura
Higher Dose of Rituxan Versus Standard Doses of Rituxan With Cyclophosphamide, Vincristine, and Prednisone in Subjects With Chronic ITP
This study is designed to compare the efficacy and safety of higher doses of Rituxan with a regimen combining standard doses of Rituxan + CVP in patients with chronic ITP who did not respond to or relapsed after standard doses of…
- Trial name
- NCT00774202
- Testing
- Rituxan, Cyclophosphamide, Vincristine, Prednisone, Higher Dose of Rituximab
- Where
- United States
- Volunteers
- 17 people
- Sponsor
- Weill Medical College of Cornell University
Alveolar Bone Loss
Graftless Maxillary Sinus Augmentation With CGF Utilizing DIVA System
This study is intended to evaluate the efficiency of graftless maxillary sinus augmentation with concentrated growth factor (CGF) utilizing "dynamic implant valve approach" (DIVA) system.
- Trial name
- NCT02985645
- Testing
- maxillary sinus augmentation with CGF, "dynamic implant valve approach" - DIVA system
- Where
- Israel
- Volunteers
- 20 people, healthy volunteers welcome
- Sponsor
- Western Galilee Hospital-Nahariya
Dental Implant Failed, Platelet-rich Fibrin
Evaluation of Dental Implants Placed in Preserved and Non-preserved Post-extraction Ridges
A prospective study to evaluate and compare implants placed in preserved versus non-preserved extraction sockets using L-PRF (Leucocyte- and platelet-rich fibrin) after 1, 3 and 5 years.
- Conditions
- Dental Implant Failed, Platelet-rich Fibrin, Alveolar Rege Preservation, Alveolar Bone Loss
- Trial name
- NCT03715439
- Testing
- Dental implant
- Where
- 2 sites in Brazil
- Volunteers
- healthy volunteers welcome
- Sponsor
- Rio de Janeiro State University
Essential Thrombocythaemia
Anagrelide Retard vs. Placebo: Efficacy and Safety in "At-risk" Patients With Essential Thrombocythaemia
This is a multicenter, phase III, randomized, subject and sponsor-blinded, placebo-controlled study to determine the treatment effect of "Anagrelide retard" in subjects with Essential Thrombocythaemia (ET) at "defined risk"…
- Trial name
- ARETA (NCT01230775)
- Testing
- Anagrelide retard
- Where
- 37 sites in Austria, Bulgaria and 7 more
- Volunteers
- 146 people
- Sponsor
- AOP Orphan Pharmaceuticals AG
Obesity
Food Preference Following Bariatric Surgery
Roux-en-Y gastric bypass (RYGB) decreases appetite, caloric intake, glycemia, and body weight, all of which are maintained long term.It is controversial whether, after RYGB, patients choose to eat less high fat and sugary foods…
- Trial name
- NCT03363581
- Testing
- Food Preference
- Where
- Ireland
- Volunteers
- 34 people, healthy volunteers welcome
- Sponsor
- Imperial College London
MDS, Myelodysplastic Syndromes
Determination of Safe and Effective Dose of Romiplostim (AMG 531) in Subjects With Myelodysplastic Syndrome (MDS)Receiving Hypomethylating Agents
The purpose of this study is to evaluate the effect of Romiplostim (AMG 531) on the incidence of clinically significant thrombocytopenic events (grade 3 or 4 and/or receipt of platelet transfusions) in subjects with low or…
- Conditions
- MDS, Myelodysplastic Syndromes, Thrombocytopenia
- Trial name
- NCT00321711
- Testing
- AMG 531 (Romiplostim), Azacitidine, Decitabine
- Volunteers
- 69 people
- Sponsor
- Amgen
Sacroiliac Joint Arthritis
Platelet-rich Plasma in the Sacroiliac Joint
This is a double-blinded study where the injecting physicians and the patients will not know which arm they are randomized to. Each participant will be followed up for 6 months following the injection, and will have in office…
- Trial name
- NCT03744234
- Testing
- PRP, Steroid Injection
- Where
- United States
- Volunteers
- 40 people
- Sponsor
- Columbia University
Abruptio Placentae; Affecting Fetus or Newborn
Normotensive and Hypertensive Placental Abruptions
Placental abruption is a significant cause of both maternal morbidity and neonatal morbidity and mortality. Most abruptions accept to be related to a chronic placental disease process.
- Trial name
- NCT04449601
- Testing
- clinical assesment
- Volunteers
- 115 people, healthy volunteers welcome
- Sponsor
- Hatice Akkaya
Idiopathic Thrombocytopenic Purpura, Anemia, Hemolytic, Autoimmune
Alemtuzumab and Rituximab in the Treatment of Refractory Autoimmune Cytopenias
The purpose of this study is to determine whether the combination of low doses of alemtuzumab and rituximab are effective in the treatment of patients with autoimmune cytopenias who has failed on steroids, relapsed after steroids…
- Trial name
- NCT00749112
- Testing
- Alemtuzumab, Rituximab
- Where
- Mexico
- Volunteers
- 19 people
- Sponsor
- Hospital Universitario Dr. Jose E. Gonzalez
Thrombosis, Hypertension
Erythropoietin and Platelet Activation Markers
We hypothesized that the effect of erythropoietin may be reflected by changes in thromboxane B2 (TXB2) and endothelial cell function.
- Trial name
- NCT01392612
- Testing
- erythropoietin
- Where
- Austria
- Volunteers
- 12 people, healthy volunteers welcome
- Sponsor
- Medical University of Vienna
Peyronie Disease, Penile Curvature
Platelet-Rich Plasma Injections From Cord Blood + Penile Traction vs. Penile Traction Alone in Patients With Peyronie's Disease. Open-label, Single-center Randomized Study
The goal of this clinical trial is to learn if Platelet-Rich Plasma Injections from Cord Blood (CB-PRP) is useful in Peyronie disease.
- Conditions
- Peyronie Disease, Penile Curvature, PRP Injection, Cord Blood
- Trial name
- CB-PRP-TRAC1 (NCT07010900)
- Testing
- Injection
- Where
- Italy
- Volunteers
- 42 people
- Sponsor
- Fondazione IRCCS Ca' Granda, Ospedale Maggiore Policlinico
Polycythemia Vera
A Two-part Study to Assess the Safety and Preliminary Efficacy of Givinostat in Patients With Polycythemia Vera
This is a two-part, multicenter, open label, non-randomized, phase Ib/II study to assess the safety and tolerability, Maximum Tolerated Dose and preliminary efficacy of Givinostat in patients with JAK2V617F positive Polycythemia…
- Trial name
- NCT01901432
- Testing
- Givinostat
- Where
- 25 sites in France, Germany and 3 more
- Volunteers
- 48 people
- Sponsor
- Italfarmaco
Malaria, Plasmodium Vivax Infection
Comparative Study of Thrombocytopenia in Plasmodium Vivax and Falciparum Malaria
This study aimed to compare platelet count patterns in patients infected with either Plasmodium vivax or Plasmodium falciparum, the two most common malaria species in Pakistan.
- Conditions
- Malaria, Plasmodium Vivax Infection, Plasmodium Falciparum Infection, Thrombocytopenia
- Trial name
- NCT07122232
- Where
- Pakistan
- Volunteers
- 177 people
- Sponsor
- Rafiullah Hotak
PRF
The Efficacy of A-PRF+ on Postoperative Outcomes Following Surgical Removal of Impacted Mandibular Third Molars (A-PRF+: Advanced Platelet Rich Fibrin)
Objectives: This study aims to evaluate the effects of A-PRF+ on postoperative pain, swelling, and trismus after surgical removal of impacted mandibular third molars.
- Trial name
- A-PRF+ (NCT05824793)
- Testing
- A-PRF+
- Where
- Vietnam
- Volunteers
- 76 people, healthy volunteers welcome
- Sponsor
- University of Medicine and Pharmacy at Ho Chi Minh City
Arteriosclerosis, Stress, Psychological
The Effect of Beta-Blockers and Aspirin on Hemostasis and Endothelial Function After Acute Mental Stress
This randomized double-blinded controlled trial uses a factorial design to investigate whether application of beta-blockers (inderal 80 mg) or aspirin (100 mg) or a combination thereof has an effect on the activation of the…
- Trial name
- NCT00174902
- Testing
- inderal (drug), acetylsalicylic acid (drug)
- Where
- Switzerland
- Volunteers
- 80 people, healthy volunteers welcome
- Sponsor
- Swiss Federal Institute of Technology
Idiopathic Thrombocytopenia Purpura
A Chart Review of Rituximab Plus Repeated Cycles of Dexamethasone
In this prospective and retrospective chart review, investigators will evaluate the response rates and duration of response for patients with relapsed and refractory idiopathic thrombocytopenic purpura (ITP) who have been treated…
- Trial name
- Dex/Rituxan (NCT02050581)
- Where
- United States
- Volunteers
- 72 people
- Sponsor
- Weill Medical College of Cornell University
Immune Thrombocytopenia
A Multicentre Investigation of 2 Cycles Rituximab Compared With Standard Regimen in Management of Steroid-Resistant/Relapsed Immune Thrombocytopenia （ITP）
The project was undertaking by Qilu Hospital, Shandong University and other several well-known hospitals in China. In order to report the efficacy and safety of Rituximab in different frequencies for the treatment of adults with…
- Trial name
- NCT02137681
- Testing
- Rituximab
- Where
- China
- Sponsor
- Shandong University
Atypical Hemolytic Uremic Syndrome(aHUS)
A Prospective, Non-interventional, Observational Study of Presentation, Treatment Patterns and Outcomes in Atypical Hemolytic Uremic Syndrome Patients
This is a China, non-interventional, observational study and will follow the Good Phar-macoepidemiology Practices guidelines. This study will enrol paediatric and adult patients diagnosed with aHUS who will be treated according…
- Trial name
- NCT06099236
- Where
- 26 sites in China
- Volunteers
- 367 people
- Sponsor
- AstraZeneca
Polycythemia Vera, Essential Thrombocythemia
Dual Vaccine Trial in Myeloproliferative Neoplasms
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and…
- Trial name
- NCT04051307
- Testing
- PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL, Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
- Where
- 2 sites in Denmark
- Volunteers
- 9 people
- Sponsor
- Inge Marie Svane
Von Willebrand Diseases
Bleeding Incidence in VWD Patients Undergoing On-Demand Treatment
The purpose of this study is to prospectively obtain reliable data on the bleeding and treatment pattern of patients with VWD undergoing on-demand treatment with a VWF-containing product over a period of 6 months.
- Trial name
- NCT04053699
- Testing
- Von Willebrand Factor-Containing Product
- Where
- 15 sites in United States, Belarus and 6 more
- Volunteers
- 56 people
- Sponsor
- Octapharma
The first 1,020 results can be paged through. Add a filter or change the sort order to reach the rest.