Clinical trials: Disorders, Blood Coagulation
Brain Tumor, Vascular Lesion
Factor XIII and Pulmonary Embolism in Neurosurgical Patients
Two studies (Gerlach et al. 2000; Gerlach et al. 2002) described the impact of factor XIII on the risk of prospective hemorrhage for patients undergoing craniotomy.
- Conditions
- Brain Tumor, Vascular Lesion, Factor XIII Deficiency, Pulmonary Embolism
- Trial name
- NCT01106937
- Where
- Germany
- Volunteers
- 130 people
- Sponsor
- Ludwig-Maximilians - University of Munich
Idiopathic Thrombocytopenic Purpura, Anemia, Hemolytic, Autoimmune
Alemtuzumab and Rituximab in the Treatment of Refractory Autoimmune Cytopenias
The purpose of this study is to determine whether the combination of low doses of alemtuzumab and rituximab are effective in the treatment of patients with autoimmune cytopenias who has failed on steroids, relapsed after steroids…
- Trial name
- NCT00749112
- Testing
- Alemtuzumab, Rituximab
- Where
- Mexico
- Volunteers
- 19 people
- Sponsor
- Hospital Universitario Dr. Jose E. Gonzalez
Hemophilia A or B
A Study to Describe Patient REal-world FitusiRan ExpeRience
This is a real-world, mixed-methods observational study conducted among adolescent (ages 12-17 years) and adult participants diagnosed with hemophilia A or B, with or without Factor VIII (FVIII) or Factor IX (FIX) inhibitors, who…
- Trial name
- PREFER (NCT07895381)
- Where
- United States
- Volunteers
- 100 people
- Sponsor
- Sanofi
Cardiovascular Diseases
Use of the Quantra QPlus Sytem in Cardiac Surgery
Single center retrospective study evaluating the impact of using the Quantra QPlus System to guide transfusion decisions on postoperative outcomes in patients undergoing cardiac surgery.
- Trial name
- NCT05501730
- Testing
- Quantra QPlus System
- Where
- United States
- Volunteers
- 128 people
- Sponsor
- HemoSonics LLC
Polycythemia Vera
A Two-part Study to Assess the Safety and Preliminary Efficacy of Givinostat in Patients With Polycythemia Vera
This is a two-part, multicenter, open label, non-randomized, phase Ib/II study to assess the safety and tolerability, Maximum Tolerated Dose and preliminary efficacy of Givinostat in patients with JAK2V617F positive Polycythemia…
- Trial name
- NCT01901432
- Testing
- Givinostat
- Where
- 25 sites in France, Germany and 3 more
- Volunteers
- 48 people
- Sponsor
- Italfarmaco
Hemophilia
Does the Thrombin Generation Test Performed During the Pharmacokinetic Profile of the Substitutive Factor VIII Bring Benefits to the Personalized Treatment of Pediatric Patients and Adult Hemophilia A Patients Under Prophylaxis ?
In the context of hemophilia, it is well know that the level of factor VIII alone does not reflect the clinical phenotype of the patients in an accurate way.
- Trial name
- NCT02803502
- Testing
- Chronometric method, Chromogenic method, Thrombin generation test (TGT)
- Where
- 5 sites in Belgium
- Volunteers
- 50 people
- Sponsor
- Brugmann University Hospital
Idiopathic Thrombocytopenia Purpura
A Chart Review of Rituximab Plus Repeated Cycles of Dexamethasone
In this prospective and retrospective chart review, investigators will evaluate the response rates and duration of response for patients with relapsed and refractory idiopathic thrombocytopenic purpura (ITP) who have been treated…
- Trial name
- Dex/Rituxan (NCT02050581)
- Where
- United States
- Volunteers
- 72 people
- Sponsor
- Weill Medical College of Cornell University
Fibrinogen Deficiency in Complex Cardiac Surgery
Haemocomplettan® P During Elective Complex Cardiac Surgery
Fibrinogen concentrate is increasingly used in cardiac surgery to reverse coagulopathy. Whether its use reduces blood loss, transfusion and occurrence of clinical adverse events remains unknown.
- Trial name
- NCT01124981
- Testing
- Haemocomplettan® P
- Where
- 2 sites in Netherlands
- Volunteers
- 120 people
- Sponsor
- Isala
Immune Thrombocytopenia
A Multicentre Investigation of 2 Cycles Rituximab Compared With Standard Regimen in Management of Steroid-Resistant/Relapsed Immune Thrombocytopenia （ITP）
The project was undertaking by Qilu Hospital, Shandong University and other several well-known hospitals in China. In order to report the efficacy and safety of Rituximab in different frequencies for the treatment of adults with…
- Trial name
- NCT02137681
- Testing
- Rituximab
- Where
- China
- Sponsor
- Shandong University
Hemophilia A
Study of PF-05208756, Moroctocog Alfa (AF-CC), Xyntha For Male Chinese Subjects With Hemophilia A
An open-label, single dose pharmacokinetic study of Xyntha (Moroctocog Alfa (AF-CC), Recombinant Factor VIII) in male Chinese subjects with hemophilia A
- Trial name
- NCT02461992
- Testing
- Intravenous infusions of Xyntha
- Where
- 2 sites in China
- Volunteers
- 13 people
- Sponsor
- Pfizer
Polycythemia Vera, Essential Thrombocythemia
Dual Vaccine Trial in Myeloproliferative Neoplasms
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and…
- Trial name
- NCT04051307
- Testing
- PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL, Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
- Where
- 2 sites in Denmark
- Volunteers
- 9 people
- Sponsor
- Inge Marie Svane
Factor VIII Deficiency, Congenital
Hemlibra in Mild Hemophilia A
This is a single arm, phase 4, prospective, open-label, United States single-center study to determine the hemostatic characteristics of Hemlibra (emicizumab) as measured by coagulation laboratory parameters in the mild…
- Trial name
- NCT04567511
- Testing
- Emicizumab
- Where
- United States
- Volunteers
- 20 people
- Sponsor
- Indiana Hemophilia &Thrombosis Center, Inc.
Von Willebrand Diseases
Bleeding Incidence in VWD Patients Undergoing On-Demand Treatment
The purpose of this study is to prospectively obtain reliable data on the bleeding and treatment pattern of patients with VWD undergoing on-demand treatment with a VWF-containing product over a period of 6 months.
- Trial name
- NCT04053699
- Testing
- Von Willebrand Factor-Containing Product
- Where
- 15 sites in United States, Belarus and 6 more
- Volunteers
- 56 people
- Sponsor
- Octapharma
Hemophilia a, Hemophilia B
The Safety and Tolerability of SerpinPC in Healthy Men and in Men with Severe Blood Disorders (haemophilia a and B)
The purpose of this study is to investigate the safety and activity in the body of a new drug called SerpinPC. The study will be split into 7 parts: Part 1a will be conducted in healthy male volunteers in the UK (up to 15) and…
- Trial name
- NCT04073498
- Testing
- SerpinPC
- Where
- 3 sites in Georgia, Moldova and 1 more
- Volunteers
- 39 people, healthy volunteers welcome
- Sponsor
- ApcinteX Ltd
Colon Cancer Liver Metastasis, Inflammatory Response
Argipressin's Influence on Blood Loss During Hepatic Resection
Infusion of Argipressin during hepatic resection surgery may reduce blood loss. It may also reduce transfusion requirements, and mitigate the perioperative inflammatory response compared to placebo.
- Conditions
- Colon Cancer Liver Metastasis, Inflammatory Response, Vasopressin Causing Adverse Effects in Therapeutic Use
- Trial name
- ARG-01 (NCT05293041)
- Testing
- Argipressin
- Where
- Sweden
- Volunteers
- 248 people
- Sponsor
- Kristina Svennerholm
ITP - Immune Thrombocytopenia
Immune Markers in Pediatric ITP on Second Line Therapy
Immune thrombocytopenia (ITP) is a common autoimmune disease characterized by low platelet count and increased risk of bleeding.
- Trial name
- NCT06093529
- Testing
- complete blood count, CD3+ , CD4+ , CD8+, CD16+, CD56+, IFN-γ.
- Volunteers
- 42 people
- Sponsor
- Assiut University
Chronic Myeloproliferative Disorders, Leukemia
Combination Chemotherapy in Treating Patients With Advanced Cancer
RATIONALE: Drugs used in chemotherapy use different ways to stop tumor cells from dividing so they stop growing or die. Combining more than one drug may kill more tumor cells.
- Conditions
- Chronic Myeloproliferative Disorders, Leukemia, Lymphoma, Multiple Myeloma and Plasma Cell Neoplasm
- Trial name
- NCT00003331
- Testing
- fluorouracil, leucovorin calcium, topotecan hydrochloride
- Where
- United States
- Volunteers
- 30 people
- Sponsor
- NYU Langone Health
Primary Immune Thrombocytopenia (ITP)
A Study of Ianalumab in Addition to Eltrombopag in Pediatric Patients With Primary ITP Who Failed Corticosteroids.
The purpose of this study is to assess the efficacy, safety and pharmacokinetics (PK) of ianalumab (VAY736) in addition to eltrombopag treatment; and to inform the dose of ianalumab in pediatric patients (5 to <18 years of age)…
- Trial name
- VAYHIT-P (NCT07660172)
- Testing
- Ianalumab, Eltrombopag
- Volunteers
- 36 people
- Sponsor
- Novartis Pharmaceuticals
Hemophilia A
Patient-reported Outcomes in Subjects Treated With ReFacto AF Routine Prophylaxis
This NIS aims to assess the patient-reported outcomes (PROs) in enrolled subjects
- Trial name
- NCT02718677
- Testing
- Refacto AF
- Sponsor
- Pfizer
Hemophilia
Weight-based Dosing in Hemophilia A
Hemophilia A is an inherited (genetic) disease where a protein, factor VIII (FVIII), which promotes blood clotting is missing or does not work properly. Individuals with hemophilia A are at risk for bleeding.
- Trial name
- NCT02586012
- Testing
- rFVIII
- Where
- United States
- Volunteers
- 30 people
- Sponsor
- Craig Seaman
The first 1,020 results can be paged through. Add a filter or change the sort order to reach the rest.