Clinical trials: Hematological Malignancies
Myelodysplastic Syndrome, Acute Myeloid Leukemia (AML)
Wilm's Tumor 1 (WT1) Peptide Vaccine for High Risk Hematologic Malignancy
This study will determine the safety and effectiveness of an experimental vaccine in controlling the abnormal growth of cells in patients with myelodysplastic syndrome (MDS, also known as myelodysplasia), acute myeloid leukemia…
- Conditions
- Myelodysplastic Syndrome, Acute Myeloid Leukemia (AML), Chronic Myeloid Leukemia (CML)
- Trial name
- NCT00433745
- Testing
- WT1 Peptide Vaccine
- Where
- United States
- Volunteers
- 4 people
- Sponsor
- National Heart, Lung, and Blood Institute (NHLBI)
Acute Lymphoblastic Leukemia, Acute Myelogenous Leukemia
Stem Cell Transplantation From HLA Partially-Matched Related Donors for Patients With Hematologic Malignancies
This clinical pilot trial is intended to evaluate the feasibility, efficacy and safety of hematopoietic stem cell transplantation (HSCT) from Human Leukocyte Antigen (HLA)-mismatched related donors for children and young adults…
- Conditions
- Acute Lymphoblastic Leukemia, Acute Myelogenous Leukemia, Myelodysplastic Syndrome, Chronic Myelogenous Leukemia
- Trial name
- NCT02566395
- Testing
- Radiation, Cyclophosphamide, Donor Lymphocyte Infusion (DLI)
- Where
- United States
- Volunteers
- 10 people
- Sponsor
- Northwell Health
Chronic Lymphocytic Leukemia (CLL), Diffuse Large B-cell Lymphoma (DLBCL)
Registry Platform Hematologic Malignancies (RUBIN) - Extension of Tumor Registry Lymphatic Neoplasms
The purpose of the project is to set up a national, prospective, longitudinal, multicenter registry platform to document uniform data on characteristics, molecular diagnostics, treatment and course of disease, to collect…
- Conditions
- Chronic Lymphocytic Leukemia (CLL), Diffuse Large B-cell Lymphoma (DLBCL), Follicular Lymphoma (FL), Mantle Cell Lymphoma (MCL)
- Trial name
- RUBIN (NCT06043011)
- Testing
- Routine care as per site standard.
- Where
- Germany
- Volunteers
- 2,950 people
- Sponsor
- iOMEDICO AG
Leukemia, Lymphocytic, Chronic, B-Cell, Lymphoma, B-cell Marginal Zone
Study of Oral LOXO-338 in Patients With Advanced Blood Cancers
The purpose of this study is to find out whether the study drug, LOXO-338, is safe and effective in patients with advanced blood cancer. Patients must have already received standard therapy.
- Conditions
- Leukemia, Lymphocytic, Chronic, B-Cell, Lymphoma, B-cell Marginal Zone, Lymphoma, Non-Hodgkin, Multiple Myeloma
- Trial name
- NCT05024045
- Testing
- LOXO-338, Pirtobrutinib
- Where
- 23 sites in United States, France and 2 more
- Volunteers
- 27 people
- Sponsor
- Eli Lilly and Company
Hematopoietic and Lymphoid Cell Neoplasm, Malignant Solid Neoplasm
Collection of Outcomes Data for Pregnant Patients With Cancer
This study collects treatment and outcomes information on pregnant patients who are or were pregnant with cancer. Gathering and storing health information on pregnant patients with cancer, may provide data for future research…
- Trial name
- NCT00507572
- Testing
- Medical Chart Review
- Where
- United States
- Volunteers
- 313 people
- Sponsor
- M.D. Anderson Cancer Center
Hematopoietic and Lymphoid Cell Neoplasm, Malignant Solid Neoplasm
Study of Attention and Memory Treatments for Cancer Survivors
This clinical trial investigates if certain electronic games may be effective in improving attention and memory function in cancer survivors.
- Trial name
- NCT04870320
- Testing
- Endeavor: Computer-Based Cognitive Stimulation Intervention, Words!: Computer-Based Cognitive Stimulation Intervention, Quality of Life (QOL) Questionnaires
- Where
- United States
- Volunteers
- 49 people
- Sponsor
- University of California, San Francisco
Chronic Lymphocytic Leukemia (CLL), Follicular Lymphoma ( FL)
Connected Blood Pressure Monitoring in Patients With Hematologic Malignancies Initiating Covalent BTK Inhibitors
This pilot prospective study aims to evaluate adherence to home blood pressure monitoring using connected blood pressure (BP) devices in patients with malignant B-cell hemopathies initiating covalent Bruton tyrosine kinase…
- Conditions
- Chronic Lymphocytic Leukemia (CLL), Follicular Lymphoma ( FL), Waldenstrom Macroglobulinaemia, Lymphoplasmacytic Lymphoma
- Trial name
- HEMO-CONNECT (NCT07592481)
- Testing
- Connected home blood pressure monitoring with daily IPA supervision.
- Volunteers
- 40 people
- Sponsor
- Centre Hospitalier de la côte Basque
Chronic Lymphocytic Leukemia, Small Lymphocytic Lymphoma
Safety, PK, PD, and Antitumor Activity of Vecabrutinib (SNS-062) in B Lymphoid Cancers
This is an open-label Phase 1b/2 study in patients with chronic lymphocytic leukemia/small lymphocytic lymphoma (CLL/SLL)or non hodgkin's lymphoma (NHL) who have failed prior standard of care therapies including a BTK inhibitor…
- Conditions
- Chronic Lymphocytic Leukemia, Small Lymphocytic Lymphoma, Lymphoplasmacytoid Lymphoma, Mantle-Cell Lymphoma
- Trial name
- NCT03037645
- Testing
- SNS-062
- Where
- 11 sites in United States
- Volunteers
- 39 people
- Sponsor
- Sunesis Pharmaceuticals
Hematopoietic and Lymphoid Cell Neoplasm, Malignant Solid Neoplasm
Survey Assessment of Patient and Provider Impressions of Telemedicine in Radiation Oncology
To understand more about the opinions of patients and health providers on the use of telemedicine in radiation oncology.
- Trial name
- NCT05496972
- Testing
- Survey Administration
- Where
- United States
- Volunteers
- 200 people
- Sponsor
- M.D. Anderson Cancer Center
Myeloid Leukemia, Chronic, Acute Myelogenous Leukemia
Phase 1-2 MAHCT w/ TCell Depleted Graft w/ Simultaneous Infusion Conventional and Regulatory T Cell
This study looks at giving specific types of immune cells, called regulatory T cells and conventional T cells, to patients with blood cancers who are receiving a stem cell transplant.
- Conditions
- Myeloid Leukemia, Chronic, Acute Myelogenous Leukemia, Myelodysplastic Syndromes (MDS), Lymphoma, Non-Hodgkin
- Trial name
- NCT01660607
- Testing
- CD34+ Hematopoietic Progenitor Cells (HSPC), Regulatory T-Cells (Treg), Conventional T-Cells (Tcon)
- Where
- United States
- Volunteers
- 68 people
- Sponsor
- Stanford University
Polycythemia Vera
A Two-part Study to Assess the Safety and Preliminary Efficacy of Givinostat in Patients With Polycythemia Vera
This is a two-part, multicenter, open label, non-randomized, phase Ib/II study to assess the safety and tolerability, Maximum Tolerated Dose and preliminary efficacy of Givinostat in patients with JAK2V617F positive Polycythemia…
- Trial name
- NCT01901432
- Testing
- Givinostat
- Where
- 25 sites in France, Germany and 3 more
- Volunteers
- 48 people
- Sponsor
- Italfarmaco
Lymphoma, Leukemia
Reduced-intensity, Related-donor Bone Marrow Transplantation Followed by High-dose Cyclophosphamide for Hematologic Cancers
This research is being done to learn more about reduced-intensity bone marrow transplantation (BMT), also known as a "mini" transplant for patients with blood cancers, using bone marrow from a relative.
- Conditions
- Lymphoma, Leukemia, Myelodysplastic Syndrome
- Trial name
- NCT01135329
- Testing
- Fludarabine, Busulfan, Cyclophosphamide
- Where
- United States
- Volunteers
- 15 people
- Sponsor
- Sidney Kimmel Comprehensive Cancer Center at Johns Hopkins
Aggressive B-Cell Non-Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma (CLL/SLL)
A Study of PRT2527 as Monotherapy and in Combination With Zanubrutinib or Venetoclax in Participants With R/R Hematologic Malignancies
This is a Phase 1 dose-escalation study of PRT2527, a potent and highly selective cyclin-dependent kinase (CDK) 9 inhibitor, in participants with select relapsed or refractory (R/R) hematologic malignancies.
- Conditions
- Aggressive B-Cell Non-Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma (CLL/SLL), Mantle Cell Lymphoma (MCL), Richter's Syndrome
- Trial name
- NCT05665530
- Testing
- PRT2527, Zanubrutinib, Venetoclax
- Where
- 24 sites in United States, Australia and 8 more
- Volunteers
- 86 people
- Sponsor
- Prelude Therapeutics Incorporated
Malignant Solid Tumor, Hematologic Malignancies
Cancer Patients' Performance Status Assessed Using Cardiopulmonary Exercise Testing and Wearable Data Generation
The primary objective of this study is to establish the feasibility and value of physical fitness assessment within patients receiving cytotoxic chemotherapy.
- Trial name
- NCT02844400
- Testing
- Biometric Devices, Physical Performance Testing
- Where
- United States
- Volunteers
- 67 people
- Sponsor
- UNC Lineberger Comprehensive Cancer Center
Polycythemia Vera, Essential Thrombocythemia
Dual Vaccine Trial in Myeloproliferative Neoplasms
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and…
- Trial name
- NCT04051307
- Testing
- PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL, Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
- Where
- 2 sites in Denmark
- Volunteers
- 9 people
- Sponsor
- Inge Marie Svane
Acute Myelogenous Leukemia, Multiple Myeloma
Collect and Assess Tissue Samples From Subjects With Hematologic Malignancy
This is a prospective, multicenter observational study to collect clinically annotated biospecimens in order to assess the correlation between ex vivo data generated by the Notable assay platform and clinical outcome.
- Conditions
- Acute Myelogenous Leukemia, Multiple Myeloma, Myelodysplastic Syndromes, Lymphoma
- Trial name
- (ANSWer) (NCT04014764)
- Testing
- This is a non-interventional study
- Where
- 20 sites in United States, Greece and 1 more
- Volunteers
- 119 people
- Sponsor
- Notable Labs
Accelerated Phase Chronic Myelogenous Leukemia, Acute Myeloid Leukemia With Multilineage Dysplasia Following Myelodysplastic Syndrome
A Pilot Study to Evaluate the Co-Infusion of Ex Vivo Expanded Cord Blood Cells With an Unmanipulated Cord Blood Unit in Patients Undergoing Cord Blood Transplant for Hematologic Malignancies
This phase I multicenter feasibility trial is studying the safety and potential efficacy of infusing ex vivo expanded cord blood progenitors with one unmanipulated umbilical cord blood unit for transplantation following…
- Conditions
- Accelerated Phase Chronic Myelogenous Leukemia, Acute Myeloid Leukemia With Multilineage Dysplasia Following Myelodysplastic Syndrome, Adult Acute Lymphoblastic Leukemia in Remission, Adult Acute Myeloid Leukemia in Remission
- Trial name
- NCT00343798
- Testing
- cyclophosphamide, fludarabine phosphate, cyclosporine
- Where
- 4 sites in United States
- Volunteers
- 23 people
- Sponsor
- Fred Hutchinson Cancer Center
Relapsed/Refractory B-cell Lymphomas, Diffuse Large B-Cell Lymphoma (DLBCL)
Long-term Follow-up Study for Patients Treated With CLBR001 CAR-T
This study is designed as a long-term follow-up study of participants who have receive genetically modified autologous CLBR001 CAR-T cells
- Conditions
- Relapsed/Refractory B-cell Lymphomas, Diffuse Large B-Cell Lymphoma (DLBCL), Follicular Lymphoma (FL), Chronic Lymphocytic Leukemia (CLL)
- Trial name
- NCT04488354
- Testing
- CLBR001 and SWI019
- Where
- 8 sites in United States
- Volunteers
- 16 people
- Sponsor
- Calibr, a division of Scripps Research
Chronic Myeloproliferative Disorders, Leukemia
Combination Chemotherapy in Treating Patients With Advanced Cancer
RATIONALE: Drugs used in chemotherapy use different ways to stop tumor cells from dividing so they stop growing or die. Combining more than one drug may kill more tumor cells.
- Conditions
- Chronic Myeloproliferative Disorders, Leukemia, Lymphoma, Multiple Myeloma and Plasma Cell Neoplasm
- Trial name
- NCT00003331
- Testing
- fluorouracil, leucovorin calcium, topotecan hydrochloride
- Where
- United States
- Volunteers
- 30 people
- Sponsor
- NYU Langone Health
Aggressive Non-Hodgkin Lymphoma, Blasts Under 5 Percent of Bone Marrow Nucleated Cells
Donor Atorvastatin Treatment in Preventing Severe Acute GVHD After Nonmyeloablative Peripheral Blood Stem Cell Transplant in Patients With Hematological Malignancies
This phase II trial studies how well donor atorvastatin treatment works in preventing severe graft-versus-host disease (GVHD) after nonmyeloablative peripheral blood stem cell (PBSC) transplant in patients with hematological…
- Conditions
- Aggressive Non-Hodgkin Lymphoma, Blasts Under 5 Percent of Bone Marrow Nucleated Cells, Chronic Lymphocytic Leukemia, Loss of Chromosome 17p
- Trial name
- NCT01527045
- Testing
- Atorvastatin Calcium, Cyclosporine, Fludarabine Phosphate
- Where
- 2 sites in United States
- Volunteers
- 47 people
- Sponsor
- Fred Hutchinson Cancer Center
The first 1,020 results can be paged through. Add a filter or change the sort order to reach the rest.