Clinical trials: Thrombocythemia
Colorectal Cancer, Colorectal Carcinoma
Elevated Platelet Count as Prognostic Factor in Colorectal Cancer With Synchronous Liver Metastases
Colorectal cancer (CRC) is the third most common malignancy worldwide and is often metastatic at diagnosis. Despite progresses in surgical techniques and the introduction of novel chemotherapy regimens, many patients still suffer…
- Conditions
- Colorectal Cancer, Colorectal Carcinoma, Stage IV Colon Cancer
- Trial name
- PLTCRC (NCT03717519)
- Testing
- Measurement of platelet count at diagnosis
- Where
- Italy
- Volunteers
- 196 people
- Sponsor
- Azienda Ospedaliera Universitaria Integrata Verona
Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis
Real World Evidence of Fedratinib Effectiveness in MF
This is a multicenter prospective and retrospective observational clinical study in patients with primary or post polycythemia vera or post essential thrombocythemia myelofibrosis to test the efficacy of fedratinib in the rea…
- Conditions
- Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis, Post-essential Thrombocythemia Myelofibrosis
- Trial name
- REALFed (NCT05883904)
- Testing
- Fedratinib
- Where
- Italy
- Volunteers
- 93 people
- Sponsor
- Gruppo Italiano Malattie EMatologiche dell'Adulto
Thrombocythemia, Essential, Primary Myelofibrosis
A Study to Evaluate Safety and Efficacy of Bomedemstat (MK-3543-017)
The primary purpose of the study is to transition participants into an extension study to collect long-term safety and efficacy data.
- Conditions
- Thrombocythemia, Essential, Primary Myelofibrosis, Myelofibrosis, Post-polycythemia Vera Myelofibrosis
- Trial name
- NCT06351631
- Testing
- Bomedemstat
- Where
- 21 sites in United States, Australia and 4 more
- Volunteers
- 400 people
- Sponsor
- Merck Sharp & Dohme LLC
Chronic Myeloproliferative Disorders, Fatigue
St. John's Wort in Relieving Fatigue in Patients Undergoing Chemotherapy or Hormone Therapy for Cancer
RATIONALE: Giving St. John's wort may be effective in relieving fatigue in patients with cancer who are undergoing chemotherapy or hormone therapy. PURPOSE: Randomized phase III trial to determine the effectiveness of St.
- Conditions
- Chronic Myeloproliferative Disorders, Fatigue, Leukemia, Lymphoma
- Trial name
- NCT00005805
- Testing
- St. John's wort
- Where
- United States
- Sponsor
- Memorial Sloan Kettering Cancer Center
Cervical Cancer, Chronic Myeloproliferative Disorders
Dalteparin to Prevent Complications in Cancer Patients Receiving Chemotherapy Through a Catheter
RATIONALE: The use of dalteparin may be able to prevent complications caused by the use of a catheter to supply chemotherapy to cancer patients. It is not yet known if dalteparin is effective in reducing these complications.
- Conditions
- Cervical Cancer, Chronic Myeloproliferative Disorders, Leukemia, Lymphoma
- Trial name
- NCT00006083
- Testing
- Fragmin
- Where
- United States
- Sponsor
- Jonsson Comprehensive Cancer Center
Hepatomegaly, Myelofibrosis Transformation in Essential Thrombocythemia
Nivolumab in Treating Patients With Primary Myelofibrosis, Post-Essential Thrombocythemia Myelofibrosis, or Post-Polycythemia Vera Myelofibrosis
This phase II trial studies how well nivolumab works in treating patients with primary myelofibrosis, post-essential thrombocythemia myelofibrosis, or post-polycythemia vera myelofibrosis.
- Conditions
- Hepatomegaly, Myelofibrosis Transformation in Essential Thrombocythemia, Polycythemia Vera, Post-Polycythemic Myelofibrosis Phase, Primary Myelofibrosis
- Trial name
- NCT02421354
- Testing
- Laboratory Biomarker Analysis, Nivolumab, Quality-of-Life Assessment
- Where
- United States
- Volunteers
- 8 people
- Sponsor
- M.D. Anderson Cancer Center
Myelofibrosis, Myelofibrosis Due to and Following Polycythemia Vera
Flonoltinib Maleate Oral Regimens in Patients With Myelofibrosis
The goal of this clinical trial is to learn which of three different doses of Flonoltinib Maleate taken by mouth daily works best to treat adult patients with myelofibrosis in whom the most common approved therapy has failed to…
- Conditions
- Myelofibrosis, Myelofibrosis Due to and Following Polycythemia Vera, Myelofibrosis Transformation in Essential Thrombocythemia, Myelofibrosis With High Molecular Risk Mutations
- Trial name
- FM-MF-02 (NCT07750574)
- Testing
- Flonoltinib Maleate orally
- Volunteers
- 105 people
- Sponsor
- Chengdu Zenitar Biomedical Technology Co., Ltd
Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis
Phase 2 Study: An Open-Label, Randomized, Phase 2 Dose-Finding Study of Pacritinib in Patients With Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis, or Post- Essential Thrombocythemia Myelofibrosis Previously Treated With Ruxolitinib
This was an open-label, randomized, dose-finding study in patients with primary or secondary MF (Dynamic International Prognostic Scoring System [DIPSS] risk score of Intermediate-1 to High-Risk) who were previously treated with…
- Conditions
- Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis, Post- Essential Thrombocythemia Myelofibrosis
- Trial name
- NCT04884191
- Testing
- Pacritinib
- Where
- 62 sites in United States, France and 6 more
- Volunteers
- 165 people
- Sponsor
- CTI BioPharma
Primary Myelofibrosis (MF), Post-Polycythemia Vera (PV) MF
Asian Phase II Study of INC424 in Patients With Primary Myelofibrosis (MF), Post-PV MF or Post-ET MF
The objective of this study was to determine the efficacy of INC424 as assessed by reduction in spleen volume in patients with primary myelofibrosis (MF), post-polycythemia vera (PV) MF, or post-essential thrombocythemia (ET) MF.
- Conditions
- Primary Myelofibrosis (MF), Post-Polycythemia Vera (PV) MF, Post-Essential Thrombocythemia (ET) MF
- Trial name
- NCT01392443
- Testing
- Ruxolitinib
- Where
- 26 sites in China, Japan and 2 more
- Volunteers
- 120 people
- Sponsor
- Novartis Pharmaceuticals
Essential Thrombocythemia (ET)
Effect of SPD422 on Platelet Lowering and Safety in Japanese Adults With At Risk Essential Thrombocythaemia
The purpose of this study is to investigate how effective and safe SPD422 (Anagrelide Hydrochloride) is in Japanese subjects, diagnosed with Essential Thrombocythemia, who's previously treatment has either not been effective or…
- Trial name
- NCT01214915
- Testing
- Anagrelide Hydrochloride
- Where
- 19 sites in Japan
- Volunteers
- 53 people
- Sponsor
- Shire
Chronic Myeloproliferative Disorders, Leukemia
T-Cell-Depleted Allogeneic Stem Cell Transplantation After Immunoablative Induction Chemotherapy and Reduced-Intensity Transplantation Conditioning in Treating Patients With Hematologic Malignancies
RATIONALE: Donor peripheral stem cell transplantation may be able to replace bone marrow and immune cells that were destroyed by chemotherapy. Sometimes the transplanted cells from a donor are rejected by the body's normal cells.
- Conditions
- Chronic Myeloproliferative Disorders, Leukemia, Lymphoma, Multiple Myeloma and Plasma Cell Neoplasm
- Trial name
- NCT00080925
- Testing
- filgrastim, graft-versus-tumor induction therapy, rituximab
- Where
- United States
- Volunteers
- 20 people
- Sponsor
- National Institutes of Health Clinical Center (CC)
Chronic Myeloproliferative Disorders, Leukemia
Fludarabine, Cyclophosphamide, and Total-Body Irradiation in Treating Patients Who Are Undergoing a Donor Bone Marrow Transplant for Hematologic Cancer
RATIONALE: Giving low doses of chemotherapy, such as fludarabine and cyclophosphamide, and radiation therapy before a donor bone marrow transplant helps stop the growth of cancer cells.
- Conditions
- Chronic Myeloproliferative Disorders, Leukemia, Lymphoma, Multiple Myeloma and Plasma Cell Neoplasm
- Trial name
- NCT00134004
- Testing
- cyclophosphamide, fludarabine phosphate, mycophenolate mofetil
- Where
- 3 sites in United States
- Volunteers
- 210 people
- Sponsor
- Sidney Kimmel Comprehensive Cancer Center at Johns Hopkins
Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis
A Phase 3 Study of Pacritinib in Patients With Primary Myelofibrosis, Post Polycythemia Vera Myelofibrosis, or Post-Essential Thrombocythemia Myelofibrosis
This study (study ID PAC203 North America; PAC303 ex-North America) is evaluating 200 mg BID of pacritinib compared to physician's choice (P/C) therapy in patients with MF and severe thrombocytopenia (platelet count <50,000/μL).
- Conditions
- Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis, Post-essential Thrombocythemia Myelofibrosis
- Trial name
- PACIFICA (NCT03165734)
- Testing
- Pacritinib, Physician's Choice medications
- Where
- 207 sites in United States, Australia and 22 more
- Volunteers
- 407 people
- Sponsor
- Swedish Orphan Biovitrum
Myeloproliferative Neoplasms (MPNs)
A Study to Evaluate DMR-001 in Participants With CALR-mutant Myeloproliferative Neoplasms
This is a multi-center, open-label, Phase 1/1b study designed to evaluate the safety, pharmacokinetics, immunogenicity, and preliminary efficacy of DMR-001 monotherapy in adult participants with CALR-mutated essential…
- Trial name
- CLARITY-101 (NCT07849231)
- Testing
- DMR-001, Ruxolitinib
- Where
- 36 sites in United States, Australia
- Volunteers
- 250 people
- Sponsor
- Damora Therapeutics
Chronic Myeloproliferative Disorders, Leukemia
Fenretinide in Treating Patients With Refractory or Relapsed Hematologic Cancer
RATIONALE: Drugs used in chemotherapy, such as fenretinide, work in different ways to stop the growth of cancer cells, either by killing the cells or by stopping them from dividing.
- Conditions
- Chronic Myeloproliferative Disorders, Leukemia, Lymphoma, Multiple Myeloma and Plasma Cell Neoplasm
- Trial name
- NCT00104923
- Testing
- fenretinide
- Where
- 4 sites in United States
- Volunteers
- 29 people
- Sponsor
- California Cancer Consortium
Brain and Central Nervous System Tumors, Chronic Myeloproliferative Disorders
Pemetrexed Disodium in the Cerebrospinal Fluid of Patients With Leptomeningeal Metastases
RATIONALE: Pemetrexed disodium may stop the growth of cancer cells by blocking some of the enzymes needed for cell growth. Studying samples of cerebrospinal fluid and blood from patients with cancer in the laboratory may help…
- Conditions
- Brain and Central Nervous System Tumors, Chronic Myeloproliferative Disorders, Leukemia, Lymphoma
- Trial name
- NCT00424242
- Testing
- Pemetrexed
- Where
- United States
- Volunteers
- 15 people
- Sponsor
- Northwestern University
Chronic Myelomonocytic Leukemia, de Novo Myelodysplastic Syndrome
Azacitidine and Sonidegib or Decitabine in Treating Patients With Myeloid Malignancies
This phase I/Ib trial studies the side effects and best dose of azacitidine and sonidegib or decitabine and so see how well they work in treating patients with myeloid malignancies.
- Conditions
- Chronic Myelomonocytic Leukemia, de Novo Myelodysplastic Syndrome, Essential Thrombocythemia, Myelodysplastic Syndrome
- Trial name
- NCT02129101
- Testing
- Azacitidine, Decitabine, Laboratory Biomarker Analysis
- Where
- United States
- Volunteers
- 63 people
- Sponsor
- Mayo Clinic
Chronic Myeloproliferative Disorders, Leukemia
Donor Peripheral Stem Cell Transplant in Treating Patients With Myelodysplastic Syndrome, Acute Myeloid Leukemia, or Myeloproliferative Disorder
RATIONALE: Giving chemotherapy drugs before a donor peripheral blood stem cell transplant helps stop the growth of cancer and abnormal cells and helps stop the patient's immune system from rejecting the donor's stem cells.
- Conditions
- Chronic Myeloproliferative Disorders, Leukemia, Myelodysplastic Syndromes, Myelodysplastic/Myeloproliferative Diseases
- Trial name
- NCT00049634
- Testing
- busulfan, cyclophosphamide, cyclosporine
- Where
- 2 sites in United States
- Volunteers
- 30 people
- Sponsor
- Fred Hutchinson Cancer Center
Primary Myelofibrosis, MPN-associated Myelofibrosis
Study of Pomalidomide in Persons With Myeloproliferative-Neoplasm-Associated Myelofibrosis and RBC-Transfusion-Dependence
The objective of this study is to determine whether pomalidomide is safe and effective in reversing red blood cell (RBC)-transfusion-dependence in persons with myeloproliferative neoplasm (MPN)-associated myelofibrosis (global…
- Trial name
- RESUME (NCT01178281)
- Testing
- Pomalidomide 0.5 mg, Pomalidomide
- Where
- 87 sites in United States, Australia and 14 more
- Volunteers
- 267 people
- Sponsor
- Celgene
Polycythemia Vera, Essential Thrombocythemia
Dual Vaccine Trial in Myeloproliferative Neoplasms
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and…
- Trial name
- NCT04051307
- Testing
- PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL, Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
- Where
- 2 sites in Denmark
- Volunteers
- 9 people
- Sponsor
- Inge Marie Svane