Clinical trials: Bone Marrow
Leukemia
Everolimus and Imatinib Mesylate in Treating Patients With Chronic Phase Chronic Myelogenous Leukemia Who Are Not in Complete Cytogenetic Remission After Previous Imatinib Mesylate
RATIONALE: Drugs used in chemotherapy, such as everolimus, work in different ways to stop cancer cells from dividing so they stop growing or die.
- Trial name
- NCT00093639
- Testing
- everolimus, imatinib mesylate
- Where
- United States
- Sponsor
- Novartis Pharmaceuticals
Myeloid Leukemia, Chronic, Acute Myelogenous Leukemia
Phase 1-2 MAHCT w/ TCell Depleted Graft w/ Simultaneous Infusion Conventional and Regulatory T Cell
This study looks at giving specific types of immune cells, called regulatory T cells and conventional T cells, to patients with blood cancers who are receiving a stem cell transplant.
- Conditions
- Myeloid Leukemia, Chronic, Acute Myelogenous Leukemia, Myelodysplastic Syndromes (MDS), Lymphoma, Non-Hodgkin
- Trial name
- NCT01660607
- Testing
- CD34+ Hematopoietic Progenitor Cells (HSPC), Regulatory T-Cells (Treg), Conventional T-Cells (Tcon)
- Where
- United States
- Volunteers
- 68 people
- Sponsor
- Stanford University
Acute Leukaemia, Myelodysplastic Syndrome
Natural Killer Cells in Acute Leukaemia and Myelodysplastic Syndrome
A novel method has been developed to expand natural (NK) cells and enhance their cytotoxicity against cancer cells while maintaining low killing capacity against non-transformed cells.
- Trial name
- NCT02123836
- Testing
- NK cells
- Where
- Singapore
- Volunteers
- 20 people
- Sponsor
- National University Hospital, Singapore
Cardiomyopathy, Dilated
Cell Therapy in Dilated Cardiomyopathy: Observational Study
Using bone marrow mononuclear cell in 24 patients with Idiopathic dilated cardiomyopathy
- Trial name
- NCT00612911
- Testing
- Cell therapy
- Where
- Brazil
- Volunteers
- 24 people
- Sponsor
- Ministry of Health, Brazil
Polycythemia Vera
A Two-part Study to Assess the Safety and Preliminary Efficacy of Givinostat in Patients With Polycythemia Vera
This is a two-part, multicenter, open label, non-randomized, phase Ib/II study to assess the safety and tolerability, Maximum Tolerated Dose and preliminary efficacy of Givinostat in patients with JAK2V617F positive Polycythemia…
- Trial name
- NCT01901432
- Testing
- Givinostat
- Where
- 25 sites in France, Germany and 3 more
- Volunteers
- 48 people
- Sponsor
- Italfarmaco
Acute Undifferentiated Leukemia, Adult Nasal Type Extranodal NK/T-cell Lymphoma
Fludarabine Phosphate, Low-Dose Total-Body Irradiation, and Donor Stem Cell Transplant Followed by Cyclosporine, Mycophenolate Mofetil, Donor Lymphocyte Infusion in Treating Patients With Hematopoietic Cancer
This clinical trial studies fludarabine phosphate, low-dose total-body irradiation, and donor stem cell transplant followed by cyclosporine, mycophenolate mofetil, and donor lymphocyte infusion in treating patients with…
- Conditions
- Acute Undifferentiated Leukemia, Adult Nasal Type Extranodal NK/T-cell Lymphoma, Anaplastic Large Cell Lymphoma, Angioimmunoblastic T-cell Lymphoma
- Trial name
- NCT00006251
- Testing
- total-body irradiation, fludarabine phosphate, cyclosporine
- Where
- 2 sites in United States, Italy
- Volunteers
- 21 people
- Sponsor
- Fred Hutchinson Cancer Center
Lymphoma, Leukemia
Reduced-intensity, Related-donor Bone Marrow Transplantation Followed by High-dose Cyclophosphamide for Hematologic Cancers
This research is being done to learn more about reduced-intensity bone marrow transplantation (BMT), also known as a "mini" transplant for patients with blood cancers, using bone marrow from a relative.
- Conditions
- Lymphoma, Leukemia, Myelodysplastic Syndrome
- Trial name
- NCT01135329
- Testing
- Fludarabine, Busulfan, Cyclophosphamide
- Where
- United States
- Volunteers
- 15 people
- Sponsor
- Sidney Kimmel Comprehensive Cancer Center at Johns Hopkins
Aggressive B-Cell Non-Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma (CLL/SLL)
A Study of PRT2527 as Monotherapy and in Combination With Zanubrutinib or Venetoclax in Participants With R/R Hematologic Malignancies
This is a Phase 1 dose-escalation study of PRT2527, a potent and highly selective cyclin-dependent kinase (CDK) 9 inhibitor, in participants with select relapsed or refractory (R/R) hematologic malignancies.
- Conditions
- Aggressive B-Cell Non-Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma (CLL/SLL), Mantle Cell Lymphoma (MCL), Richter's Syndrome
- Trial name
- NCT05665530
- Testing
- PRT2527, Zanubrutinib, Venetoclax
- Where
- 24 sites in United States, Australia and 8 more
- Volunteers
- 86 people
- Sponsor
- Prelude Therapeutics Incorporated
Bone Marrow Failure Syndrome, Severe Aplastic Anemia
CD34+ (Non-Malignant) Stem Cell Selection for Patients Receiving Allogeneic Stem Cell Transplantation
This study's goal is to determine the frequency and severity of acute graft versus host disease, to evaluate incidence of primary and secondary graft rejection, to assess event free survival and overall survival, to determine the…
- Conditions
- Bone Marrow Failure Syndrome, Severe Aplastic Anemia, Severe Congenital Neutropenia, Amegakaryocytic Thrombocytopenia
- Trial name
- NCT01966367
- Testing
- CD34 Stem Cell Selection Therapy
- Where
- United States
- Volunteers
- 37 people
- Sponsor
- Diane George
Chronic Myelomonocytic Leukemia, Myelodysplastic Syndrome
A Phase II, Open-Label, Study of Subcutaneous Canakinumab, an Anti-IL-1β Human Monoclonal Antibody, for Patients With Low or Int-1 Risk IPSS/IPSS-R Myelodysplastic Syndromes and Chronic Myelomonocytic Leukemia
This phase II trial studies how well canakinumab works for the treatment of low- or intermediate-risk myelodysplastic syndrome or chronic myelomonocytic leukemia.
- Conditions
- Chronic Myelomonocytic Leukemia, Myelodysplastic Syndrome, Recurrent Chronic Myelomonocytic Leukemia, Recurrent Myelodysplastic Syndrome
- Trial name
- NCT04239157
- Testing
- Canakinumab
- Where
- United States
- Volunteers
- 76 people
- Sponsor
- M.D. Anderson Cancer Center
Gender Dysphoria in Children, Puberty
Skeletal Health and Bone Marrow Composition Among Youth
Children and adolescents experiencing gender dysphoria feel increased distress with the onset of puberty. Gender clinics treat these young adolescents by "blocking" puberty using gonadotropin-releasing hormone (GnRH) agonist…
- Conditions
- Gender Dysphoria in Children, Puberty, Bone Development
- Trial name
- NCT04203381
- Testing
- GnRH Agonist
- Where
- 2 sites in United States
- Volunteers
- 78 people, healthy volunteers welcome
- Sponsor
- Amy DiVasta, MD
Trauma Injury, Trauma
The Role of Brain-Bone Marrow-Gut Interaction Following Major Trauma
Traumatic injury followed by critical illness provokes pathophysiologic changes in the bone marrow and the gut that contribute to persistent anemia and changes in the microbiome which significantly impact long-term recovery.
- Conditions
- Trauma Injury, Trauma, Critical Illness, Microbiome
- Trial name
- NCT06606119
- Testing
- Data and tissue collection
- Where
- 3 sites in United States
- Volunteers
- 275 people
- Sponsor
- University of Florida
Polycythemia Vera, Essential Thrombocythemia
Dual Vaccine Trial in Myeloproliferative Neoplasms
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and…
- Trial name
- NCT04051307
- Testing
- PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL, Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
- Where
- 2 sites in Denmark
- Volunteers
- 9 people
- Sponsor
- Inge Marie Svane
Metabolic Syndrome
Metabolic Syndrome in Bone Marrow Transplant Survivors
Life for long-term bone marrow transplant patients is complicated by endocrine late effects including growth hormone (GH) deficiency, thyroid hormone deficiency and sex steroid deficiency.
- Trial name
- NCT00855244
- Testing
- Diagnostic exams
- Where
- United States
- Volunteers
- 5 people
- Sponsor
- Nationwide Children's Hospital
Leukemia, Acute Lymphocytic (ALL), Leukemia, Acute Myelogenous (AML)
CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
The main purpose of this study is to verify the safety and potential effectiveness of CART cells combined with peptide specific dendritic cell in relapsed/refractory leukemia.
- Conditions
- Leukemia, Acute Lymphocytic (ALL), Leukemia, Acute Myelogenous (AML), Myelodysplastic Syndromes
- Trial name
- NCT03291444
- Testing
- Chimeric antigen receptor T cells, peptide specific dendritic cell
- Where
- China
- Volunteers
- 30 people
- Sponsor
- Zhujiang Hospital
Acute Myelogenous Leukemia, Multiple Myeloma
Collect and Assess Tissue Samples From Subjects With Hematologic Malignancy
This is a prospective, multicenter observational study to collect clinically annotated biospecimens in order to assess the correlation between ex vivo data generated by the Notable assay platform and clinical outcome.
- Conditions
- Acute Myelogenous Leukemia, Multiple Myeloma, Myelodysplastic Syndromes, Lymphoma
- Trial name
- (ANSWer) (NCT04014764)
- Testing
- This is a non-interventional study
- Where
- 20 sites in United States, Greece and 1 more
- Volunteers
- 119 people
- Sponsor
- Notable Labs
Acute Myeloid Leukemia, Myelodysplastic Syndrome
L-Ascorbic Acid Depletion to Treat Acute Myeloid Leukemia and Myelodysplastic Syndromes
To document therapeutic gain achieved by cyclic application of L-ascorbic acid (LAA) supplementation and depletion, while confirming safety and avoidance of clinically significant scurvy, in chemorefractory patients with acute…
- Trial name
- NCT00329498
- Testing
- L-Ascorbic Acid
- Where
- South Korea
- Volunteers
- 25 people
- Sponsor
- Samsung Medical Center
Accelerated Phase Chronic Myelogenous Leukemia, Acute Myeloid Leukemia With Multilineage Dysplasia Following Myelodysplastic Syndrome
A Pilot Study to Evaluate the Co-Infusion of Ex Vivo Expanded Cord Blood Cells With an Unmanipulated Cord Blood Unit in Patients Undergoing Cord Blood Transplant for Hematologic Malignancies
This phase I multicenter feasibility trial is studying the safety and potential efficacy of infusing ex vivo expanded cord blood progenitors with one unmanipulated umbilical cord blood unit for transplantation following…
- Conditions
- Accelerated Phase Chronic Myelogenous Leukemia, Acute Myeloid Leukemia With Multilineage Dysplasia Following Myelodysplastic Syndrome, Adult Acute Lymphoblastic Leukemia in Remission, Adult Acute Myeloid Leukemia in Remission
- Trial name
- NCT00343798
- Testing
- cyclophosphamide, fludarabine phosphate, cyclosporine
- Where
- 4 sites in United States
- Volunteers
- 23 people
- Sponsor
- Fred Hutchinson Cancer Center
Chronic Myeloid Leukemia (CML), Chronic Myeloid Leukemia (CML) Philadelphia Chromosome Positive
A Randomized Study of ELVN-001 Versus Investigator-Selected TKI, in CP-CML Previously Treated With One or More TKIs
The study is designed to compare the efficacy of ELVN-001 versus Investigator-selected tyrosine kinase inhibitor (TKI) for adults with previously treated chronic myeloid leukemia in the chronic phase (CP-CML).
- Conditions
- Chronic Myeloid Leukemia (CML), Chronic Myeloid Leukemia (CML) Philadelphia Chromosome Positive, Chronic Phase Chronic Myeloid Leukemia, BCR::ABL1 Positive CML
- Trial name
- ENABLE-2 (NCT07905183)
- Testing
- ELVN-001, TKI
- Volunteers
- 450 people
- Sponsor
- Enliven Therapeutics
Myelodysplastic Syndromes
Safety of Lenalidomide and Markers for Disease Progression in Patients With International Prognostic Scoring System (IPSS) Low- or Intermediate-1 Risk Myelodysplastic Syndromes (MDS) With Isolated del5q
The purpose of this study is to determine the safety of lenalidomide and markers for disease progression in the treatment of IPSS low- or intermediate-1 risk MDS with isolated del5q.
- Trial name
- MDS-LE-MON-5 (NCT01081431)
- Testing
- Lenalidomide
- Where
- 12 sites in Germany
- Volunteers
- 91 people
- Sponsor
- Gesellschaft fur Medizinische Innovation - Hamatologie und Onkologie mbH
The first 1,020 results can be paged through. Add a filter or change the sort order to reach the rest.