Clinical trials: Myeloproliferative Disease
Acute Myeloid Leukemia, Myelodysplastic Syndrome
Clofarabine Combinations in Relapsed/Refractory Acute Myeloid Leukemia (AML), Myelodysplastic Syndromes (MDS) and Myeloid Blast Phase Chronic Myeloid Leukemia (CML)
The goal is to compare the drug combinations clofarabine/idarubicin/ara-C, clofarabine/ara-C, and clofarabine/idarubicin in the treatment of patients with Acute Myeloid Leukemia, high-grade MDS, or myeloid blast phase of Chronic…
- Conditions
- Acute Myeloid Leukemia, Myelodysplastic Syndrome, Chronic Myeloid Leukemia
- Trial name
- NCT00067028
- Testing
- Clofarabine 40mg/m^2, Idarubicin 10mg/m^2, Ara-C 0.75 g/m^2
- Where
- United States
- Volunteers
- 116 people
- Sponsor
- M.D. Anderson Cancer Center
Leukemia
Chemotherapy, Interferon, and Bone Marrow Transplantation in Treating Patients With Chronic Myelogenous Leukemia
RATIONALE: Drugs used in chemotherapy use different ways to stop cancer cells from dividing so they stop growing or die. Combining chemotherapy with bone marrow transplantation may allow the doctor to give higher doses of…
- Trial name
- NCT00002771
- Testing
- recombinant interferon alfa, busulfan, cytarabine
- Where
- Germany
- Volunteers
- 750 people
- Sponsor
- German CML Study Group
Chronic Myeloid Leukemia
Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia in Accelerated and Blastic Phase
This is a phase II, multi-center, open-label, non-randomized trial. During Part 1 of the trial, patients will receive once daily oral administration of STI571 at a dose of 600 mg for 24 weeks.
- Trial name
- CML003 (NCT00514969)
- Testing
- Imatinib (STI571)
- Where
- Italy
- Sponsor
- University of Bologna
Accelerated Phase Chronic Myelogenous Leukemia (CML), Blast Phase Chronic Myelogenous Leukemia (CML)
Axitinib and Bosutinib in Treating Patients With Chronic, Accelerated, or Blastic Phase Chronic Myeloid Leukemia
This phase I/II trial studies the side effects and best dose of axitinib and bosutinib and how well they work in treating patients with chronic, accelerated, or blastic phase chronic myeloid leukemia.
- Conditions
- Accelerated Phase Chronic Myelogenous Leukemia (CML), Blast Phase Chronic Myelogenous Leukemia (CML), Chronic Phase Phase Chronic Myelogenous Leukemia (CML), Philadelphia Chromosome Positive (Ph+) Phase Chronic Myelogenous Leukemia (CML)
- Trial name
- NCT02782403
- Testing
- Axitinib, Bosutinib, Laboratory Biomarker Analysis
- Where
- United States
- Volunteers
- 4 people
- Sponsor
- M.D. Anderson Cancer Center
Essential Thrombocythaemia
Anagrelide Retard vs. Placebo: Efficacy and Safety in "At-risk" Patients With Essential Thrombocythaemia
This is a multicenter, phase III, randomized, subject and sponsor-blinded, placebo-controlled study to determine the treatment effect of "Anagrelide retard" in subjects with Essential Thrombocythaemia (ET) at "defined risk"…
- Trial name
- ARETA (NCT01230775)
- Testing
- Anagrelide retard
- Where
- 37 sites in Austria, Bulgaria and 7 more
- Volunteers
- 146 people
- Sponsor
- AOP Orphan Pharmaceuticals AG
Leukemia
Etanercept (Enbrel) for Juvenile Myelomonocytic Leukemia
Primary Objectives: 1.1 Estimate rate of response and define acute toxicity to etanercept used in an up-front phase II window in newly diagnosed or relapsed JMML.
- Trial name
- NCT00509600
- Testing
- Etanercept
- Where
- United States
- Volunteers
- 1 people
- Sponsor
- M.D. Anderson Cancer Center
Leukemia
Everolimus and Imatinib Mesylate in Treating Patients With Chronic Phase Chronic Myelogenous Leukemia Who Are Not in Complete Cytogenetic Remission After Previous Imatinib Mesylate
RATIONALE: Drugs used in chemotherapy, such as everolimus, work in different ways to stop cancer cells from dividing so they stop growing or die.
- Trial name
- NCT00093639
- Testing
- everolimus, imatinib mesylate
- Where
- United States
- Sponsor
- Novartis Pharmaceuticals
Myeloid Leukemia, Chronic, Acute Myelogenous Leukemia
Phase 1-2 MAHCT w/ TCell Depleted Graft w/ Simultaneous Infusion Conventional and Regulatory T Cell
This study looks at giving specific types of immune cells, called regulatory T cells and conventional T cells, to patients with blood cancers who are receiving a stem cell transplant.
- Conditions
- Myeloid Leukemia, Chronic, Acute Myelogenous Leukemia, Myelodysplastic Syndromes (MDS), Lymphoma, Non-Hodgkin
- Trial name
- NCT01660607
- Testing
- CD34+ Hematopoietic Progenitor Cells (HSPC), Regulatory T-Cells (Treg), Conventional T-Cells (Tcon)
- Where
- United States
- Volunteers
- 68 people
- Sponsor
- Stanford University
Polycythemia Vera
A Two-part Study to Assess the Safety and Preliminary Efficacy of Givinostat in Patients With Polycythemia Vera
This is a two-part, multicenter, open label, non-randomized, phase Ib/II study to assess the safety and tolerability, Maximum Tolerated Dose and preliminary efficacy of Givinostat in patients with JAK2V617F positive Polycythemia…
- Trial name
- NCT01901432
- Testing
- Givinostat
- Where
- 25 sites in France, Germany and 3 more
- Volunteers
- 48 people
- Sponsor
- Italfarmaco
Acute Undifferentiated Leukemia, Adult Nasal Type Extranodal NK/T-cell Lymphoma
Fludarabine Phosphate, Low-Dose Total-Body Irradiation, and Donor Stem Cell Transplant Followed by Cyclosporine, Mycophenolate Mofetil, Donor Lymphocyte Infusion in Treating Patients With Hematopoietic Cancer
This clinical trial studies fludarabine phosphate, low-dose total-body irradiation, and donor stem cell transplant followed by cyclosporine, mycophenolate mofetil, and donor lymphocyte infusion in treating patients with…
- Conditions
- Acute Undifferentiated Leukemia, Adult Nasal Type Extranodal NK/T-cell Lymphoma, Anaplastic Large Cell Lymphoma, Angioimmunoblastic T-cell Lymphoma
- Trial name
- NCT00006251
- Testing
- total-body irradiation, fludarabine phosphate, cyclosporine
- Where
- 2 sites in United States, Italy
- Volunteers
- 21 people
- Sponsor
- Fred Hutchinson Cancer Center
Lymphoma, Leukemia
Reduced-intensity, Related-donor Bone Marrow Transplantation Followed by High-dose Cyclophosphamide for Hematologic Cancers
This research is being done to learn more about reduced-intensity bone marrow transplantation (BMT), also known as a "mini" transplant for patients with blood cancers, using bone marrow from a relative.
- Conditions
- Lymphoma, Leukemia, Myelodysplastic Syndrome
- Trial name
- NCT01135329
- Testing
- Fludarabine, Busulfan, Cyclophosphamide
- Where
- United States
- Volunteers
- 15 people
- Sponsor
- Sidney Kimmel Comprehensive Cancer Center at Johns Hopkins
Aggressive B-Cell Non-Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma (CLL/SLL)
A Study of PRT2527 as Monotherapy and in Combination With Zanubrutinib or Venetoclax in Participants With R/R Hematologic Malignancies
This is a Phase 1 dose-escalation study of PRT2527, a potent and highly selective cyclin-dependent kinase (CDK) 9 inhibitor, in participants with select relapsed or refractory (R/R) hematologic malignancies.
- Conditions
- Aggressive B-Cell Non-Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma (CLL/SLL), Mantle Cell Lymphoma (MCL), Richter's Syndrome
- Trial name
- NCT05665530
- Testing
- PRT2527, Zanubrutinib, Venetoclax
- Where
- 24 sites in United States, Australia and 8 more
- Volunteers
- 86 people
- Sponsor
- Prelude Therapeutics Incorporated
Chronic Myelomonocytic Leukemia, Myelodysplastic Syndrome
A Phase II, Open-Label, Study of Subcutaneous Canakinumab, an Anti-IL-1β Human Monoclonal Antibody, for Patients With Low or Int-1 Risk IPSS/IPSS-R Myelodysplastic Syndromes and Chronic Myelomonocytic Leukemia
This phase II trial studies how well canakinumab works for the treatment of low- or intermediate-risk myelodysplastic syndrome or chronic myelomonocytic leukemia.
- Conditions
- Chronic Myelomonocytic Leukemia, Myelodysplastic Syndrome, Recurrent Chronic Myelomonocytic Leukemia, Recurrent Myelodysplastic Syndrome
- Trial name
- NCT04239157
- Testing
- Canakinumab
- Where
- United States
- Volunteers
- 76 people
- Sponsor
- M.D. Anderson Cancer Center
Polycythemia Vera, Essential Thrombocythemia
Dual Vaccine Trial in Myeloproliferative Neoplasms
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and…
- Trial name
- NCT04051307
- Testing
- PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL, Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
- Where
- 2 sites in Denmark
- Volunteers
- 9 people
- Sponsor
- Inge Marie Svane
Acute Myelogenous Leukemia, Multiple Myeloma
Collect and Assess Tissue Samples From Subjects With Hematologic Malignancy
This is a prospective, multicenter observational study to collect clinically annotated biospecimens in order to assess the correlation between ex vivo data generated by the Notable assay platform and clinical outcome.
- Conditions
- Acute Myelogenous Leukemia, Multiple Myeloma, Myelodysplastic Syndromes, Lymphoma
- Trial name
- (ANSWer) (NCT04014764)
- Testing
- This is a non-interventional study
- Where
- 20 sites in United States, Greece and 1 more
- Volunteers
- 119 people
- Sponsor
- Notable Labs
Accelerated Phase Chronic Myelogenous Leukemia, Acute Myeloid Leukemia With Multilineage Dysplasia Following Myelodysplastic Syndrome
A Pilot Study to Evaluate the Co-Infusion of Ex Vivo Expanded Cord Blood Cells With an Unmanipulated Cord Blood Unit in Patients Undergoing Cord Blood Transplant for Hematologic Malignancies
This phase I multicenter feasibility trial is studying the safety and potential efficacy of infusing ex vivo expanded cord blood progenitors with one unmanipulated umbilical cord blood unit for transplantation following…
- Conditions
- Accelerated Phase Chronic Myelogenous Leukemia, Acute Myeloid Leukemia With Multilineage Dysplasia Following Myelodysplastic Syndrome, Adult Acute Lymphoblastic Leukemia in Remission, Adult Acute Myeloid Leukemia in Remission
- Trial name
- NCT00343798
- Testing
- cyclophosphamide, fludarabine phosphate, cyclosporine
- Where
- 4 sites in United States
- Volunteers
- 23 people
- Sponsor
- Fred Hutchinson Cancer Center
Chronic Myeloid Leukemia (CML), Chronic Myeloid Leukemia (CML) Philadelphia Chromosome Positive
A Randomized Study of ELVN-001 Versus Investigator-Selected TKI, in CP-CML Previously Treated With One or More TKIs
The study is designed to compare the efficacy of ELVN-001 versus Investigator-selected tyrosine kinase inhibitor (TKI) for adults with previously treated chronic myeloid leukemia in the chronic phase (CP-CML).
- Conditions
- Chronic Myeloid Leukemia (CML), Chronic Myeloid Leukemia (CML) Philadelphia Chromosome Positive, Chronic Phase Chronic Myeloid Leukemia, BCR::ABL1 Positive CML
- Trial name
- ENABLE-2 (NCT07905183)
- Testing
- ELVN-001, TKI
- Volunteers
- 450 people
- Sponsor
- Enliven Therapeutics
Chronic Myeloproliferative Disorders, Leukemia
Combination Chemotherapy in Treating Patients With Advanced Cancer
RATIONALE: Drugs used in chemotherapy use different ways to stop tumor cells from dividing so they stop growing or die. Combining more than one drug may kill more tumor cells.
- Conditions
- Chronic Myeloproliferative Disorders, Leukemia, Lymphoma, Multiple Myeloma and Plasma Cell Neoplasm
- Trial name
- NCT00003331
- Testing
- fluorouracil, leucovorin calcium, topotecan hydrochloride
- Where
- United States
- Volunteers
- 30 people
- Sponsor
- NYU Langone Health
Aggressive Non-Hodgkin Lymphoma, Blasts Under 5 Percent of Bone Marrow Nucleated Cells
Donor Atorvastatin Treatment in Preventing Severe Acute GVHD After Nonmyeloablative Peripheral Blood Stem Cell Transplant in Patients With Hematological Malignancies
This phase II trial studies how well donor atorvastatin treatment works in preventing severe graft-versus-host disease (GVHD) after nonmyeloablative peripheral blood stem cell (PBSC) transplant in patients with hematological…
- Conditions
- Aggressive Non-Hodgkin Lymphoma, Blasts Under 5 Percent of Bone Marrow Nucleated Cells, Chronic Lymphocytic Leukemia, Loss of Chromosome 17p
- Trial name
- NCT01527045
- Testing
- Atorvastatin Calcium, Cyclosporine, Fludarabine Phosphate
- Where
- 2 sites in United States
- Volunteers
- 47 people
- Sponsor
- Fred Hutchinson Cancer Center
Leukemia
Dasatinib Combination Therapy With the Smoothened (SMO) Inhibitor BMS-833923 in Chronic Myeloid Leukemia (CML)
The purpose of the study is to determine the safety and tolerability of the combination of BMS-833923 plus dasatinib in patients with chronic myeloid leukemia.
- Trial name
- NCT01218477
- Testing
- Dasatinib, BMS-833923
- Where
- 12 sites in United States, Canada and 5 more
- Volunteers
- 33 people
- Sponsor
- Bristol-Myers Squibb
The first 1,020 results can be paged through. Add a filter or change the sort order to reach the rest.