Clinical trials: Platelet
Tendinopathy, Rheumatic Diseases
Performance-Enhancing Effects of Platelet-Rich Plasma (PRP) Injections
Platelet-Rich Plasma (PRP) has been banned in competitive athletes because some people think it may enhance athletic performance. However, there is very little published research to support or undermine this point of view.
- Trial name
- NCT01200875
- Testing
- Ultrasound-guided platelet-rich-plasma (PRP) injection, Platelet-Rich Plasma (PRP)
- Where
- United States
- Volunteers
- 25 people
- Sponsor
- Stanford University
Chronic Myelomonocytic Leukemia, de Novo Myelodysplastic Syndrome
Azacitidine and Sonidegib or Decitabine in Treating Patients With Myeloid Malignancies
This phase I/Ib trial studies the side effects and best dose of azacitidine and sonidegib or decitabine and so see how well they work in treating patients with myeloid malignancies.
- Conditions
- Chronic Myelomonocytic Leukemia, de Novo Myelodysplastic Syndrome, Essential Thrombocythemia, Myelodysplastic Syndrome
- Trial name
- NCT02129101
- Testing
- Azacitidine, Decitabine, Laboratory Biomarker Analysis
- Where
- United States
- Volunteers
- 63 people
- Sponsor
- Mayo Clinic
Thrombocytopenia, Hepatocellular Carcinoma
Avatrombopag for HCC Patients With Thrombocytopenia Who Intend to Undergo TACE and/or HAIC
This study is conducted to evaluate the efficacy of avatrombopag for thrombocytopenia in patients with hepatocellular carcinoma (HCC) who intend to undergo transarterial chemoembolization (TACE) and/or hepatic arterial infusion…
- Trial name
- NCT06001567
- Testing
- Avatrombopag
- Where
- China
- Volunteers
- 30 people
- Sponsor
- Second Affiliated Hospital of Guangzhou Medical University
Patients With Acute Coronary Syndrome
Prasugrel Versus Clopidogrel in Acute Coronary Syndrome (ACS) Undergoing Percutaneous Coronary Intervention (PCI)
Background: Both prasugrel and clopidogrel are prescribed drugs which compete as platelet inhibitors in patients with acute coronary syndrome (ACS).
- Trial name
- NCT01090336
- Where
- Germany
- Volunteers
- 26 people
- Sponsor
- Heidelberg University
Chronic Myeloproliferative Disorders, Leukemia
Donor Peripheral Stem Cell Transplant in Treating Patients With Myelodysplastic Syndrome, Acute Myeloid Leukemia, or Myeloproliferative Disorder
RATIONALE: Giving chemotherapy drugs before a donor peripheral blood stem cell transplant helps stop the growth of cancer and abnormal cells and helps stop the patient's immune system from rejecting the donor's stem cells.
- Conditions
- Chronic Myeloproliferative Disorders, Leukemia, Myelodysplastic Syndromes, Myelodysplastic/Myeloproliferative Diseases
- Trial name
- NCT00049634
- Testing
- busulfan, cyclophosphamide, cyclosporine
- Where
- 2 sites in United States
- Volunteers
- 30 people
- Sponsor
- Fred Hutchinson Cancer Center
Glanzmann Thrombasthenia
A Phase 1/2 Study to Investigate Safety, Tolerability, Pharmacokinetics, Pharmacodynamics, and Efficacy of HMB-001 in Glanzmann Thrombasthenia
The goal of this clinical trial is to Investigate the Safety, Tolerability, Pharmacokinetics, Pharmacodynamics, and Efficacy of HMB-001 in Participants with Glanzmann Thrombasthenia.
- Trial name
- NCT06211634
- Testing
- HMB-001
- Where
- 17 sites in United States, Belgium and 4 more
- Volunteers
- 57 people
- Sponsor
- Hemab ApS
Healthy Volunteers
A Study of the Effect of Epinephrine on Platelet Reactivity in Subjects Treated With Ticagrelor
The study is an experimental observational study in ten healthy volunteers. Based on an in vitro study, it is hypothesize that a low dose epinephrine infusion will improve platelet function in healthy volunteers who have received…
- Trial name
- NCT03441412
- Testing
- Ticagrelor 90mg, Epinephrine, Metoprolol
- Where
- Sweden
- Volunteers
- 10 people, healthy volunteers welcome
- Sponsor
- Vastra Gotaland Region
Acute Coronary Syndrome Patients With Diabetes After PCI
A sTudy of Low Dose vs Standard Dose of tIcaGrelor on Platelet Function After intErvention for Acute Coronary syndRome in Diabetes Mellitus Patients
In this study, the investigates try to confirm the hypothesis that low dose ticagrelor(60mg) had similar anti-platelets function compared with the standard dose ticagrelor in acute coronary syndrome patients with diabetes.
- Trial name
- TIGER-diabetes (NCT04307511)
- Testing
- Ticagrelor, Aspirin
- Where
- China
- Volunteers
- 40 people
- Sponsor
- Shanghai Tong Ren Hospital
Stable Coronary Artery Disease, Acute Coronary Syndrome
ReAssessment of Anti-Platelet Therapy Using an InDividualized Strategy Based on GENetic Evaluation
The objective of the RAPID GENE study is to evaluate the feasibility, efficacy and safety of a pharmacogenomic approach to anti-platelet therapy following coronary artery stenting using a CYP2C19*2 point-of-care genetic test.
- Conditions
- Stable Coronary Artery Disease, Acute Coronary Syndrome, Percutaneous Coronary Intervention
- Trial name
- RAPID GENE (NCT01184300)
- Testing
- Point-of-care genetic screening with subsequent prasugrel administration to CYP2C19*2 carriers
- Where
- Canada
- Volunteers
- 200 people
- Sponsor
- Ottawa Heart Institute Research Corporation
Acne Atrophica, PRP
Poly-L-Lactic Acid Threads Versus Platelet-Rich Plasma for Post-Traumatic Atrophic Scars
This study compares the efficacy and safety of poly-L-lactic acid (PLLA) threads versus platelet-rich plasma (PRP), both combined with subcision, in the treatment of post-traumatic atrophic scars.
- Trial name
- PLLA-PRP PTAS (NCT07775092)
- Testing
- subcision and PLLA threads' insertion, PRP and subcision (PRP-S)
- Where
- Egypt
- Volunteers
- 48 people
- Sponsor
- Tanta University
Knee Pain, Knee Injuries
Effect of PRP Injection After Arthroscopic Meniscal Repair in the Healing Process
The investigator's hypothesis was that intra-articular knee injection with PRP in patients underwent arthroscopic meniscal repair and didn't receive intra-surgical PRP, may add beneficial effect on post-meniscal repair outcomes…
- Trial name
- KneePRP (NCT03910036)
- Testing
- platelet rich plasma
- Where
- Egypt
- Volunteers
- 30 people, healthy volunteers welcome
- Sponsor
- Alexandria University
Polycythemia Vera, Essential Thrombocythemia
Dual Vaccine Trial in Myeloproliferative Neoplasms
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and…
- Trial name
- NCT04051307
- Testing
- PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL, Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
- Where
- 2 sites in Denmark
- Volunteers
- 9 people
- Sponsor
- Inge Marie Svane
Simple Anal Fistula
Effect of Platelet-Rich Plasma Injection on Wound Healing After Fistulotomy for Simple Anal Fistula Randomized Controlled Trial (RCT)
Anal fistula is a common benign anorectal condition characterized by an abnormal tract between the anal canal and perianal skin, often resulting from cryptoglandular infection.
- Trial name
- PRPIWHAFSAFRCT (NCT07248007)
- Testing
- PRP injection
- Volunteers
- 70 people
- Sponsor
- Assiut University
Chronic Apical Periodontitis, Necrosis of Pulp
Using Platelet-rich Fibrin in Regenerative Endodontic Treatment in Mature Permanent Teeth
This study aims to evaluate the antibacterial effects of injectable platelet-rich fibrin (i-PRF) in vitro, and to assess the clinical and radiographic outcomes of using advanced platelet-rich fibrin (A-PRF+) and i-PRF in…
- Conditions
- Chronic Apical Periodontitis, Necrosis of Pulp, Acute Apical Periodontitis of Pulpal Origin, Periapical Abscess
- Trial name
- NCT07192289
- Testing
- Using advanced platelet-rich fibrin (A-PRF+) or injectable platelet-rich fibrin (i-PRF) in regenerative endodontic treatment in mature permanent teeth.
- Where
- Vietnam
- Volunteers
- 57 people, healthy volunteers welcome
- Sponsor
- University of Medicine and Pharmacy at Ho Chi Minh City
Healthy
In Vivo Study to Assess the Recovery and Survival of Radiolabeled Autologous INTERCEPT Apheresis Platelet Components Suspended in 100% Plasma Stored for up to 7 Days
The principle objective of this study is to evaluate the hypothesis that INTERCEPT Platelets in 100% plasma stored for 5 or more days (up to 7 days) after apheresis collection retain sufficient viability for therapeutic…
- Trial name
- NCT04022889
- Testing
- INTERCEPT Treated Platelets
- Where
- 2 sites in United States
- Volunteers
- 37 people, healthy volunteers welcome
- Sponsor
- Cerus Corporation
Lung Cancer, Chemotherapy-Induced Thrombocytopenia
Dose/ Schedule Finding Trial of Romiplostim for Chemotherapy-Induced Thrombocytopenia (CIT) in Non-Small Cell Lung Cancer (NSCLC)
The purpose of this study is to identify an effective, well tolerated dose and schedule of romiplostim that is appropriate for the treatment of chemotherapy induced thrombocytopenia (CIT) in patients with non-small cell lung…
- Conditions
- Lung Cancer, Chemotherapy-Induced Thrombocytopenia, Non-Small Cell Lung Cancer, Cancer
- Trial name
- NCT00413283
- Testing
- Romiplostim, Gemcitabine, Carboplatin
- Where
- 113 sites in United States, Austria and 6 more
- Volunteers
- 63 people
- Sponsor
- Amgen
Thrombocytopenia
The Study of rHuTPO/rHuIL-11 in the Treatment for Chemotherapy-induced Thrombocytopenia in Patients With NSCLC
Purpose: To evaluate the efficacy and safety of rHuTPO/rHuIL-11 in the treatment for chemotherapy-induced thrombocytopenia in patients with NSCLC receiving gemcitabine and cisplatin or carboplatin chemotherapy.
- Trial name
- NCT02344979
- Where
- China
- Volunteers
- 120 people
- Sponsor
- Shenyang Sunshine Pharmaceutical Co., LTD.
Root Resorption
Treatment of Internal Inflammatory Root Resorption Using Injectable PRF Revascularization Technque
Currently Endodontics looks forward for regeneration rather than repair. Regenerative endodontic therapy was limited to pulp revascularization of necrotic pulp in immature teeth , followed by mature teeth.
- Trial name
- NCT04410679
- Testing
- injectable PRF
- Where
- Egypt
- Volunteers
- 10 people, healthy volunteers welcome
- Sponsor
- Fayoum University
Thalassemia in Children
Observational Study: Romiplostim for Platelet Recovery in Haploidentical HSCT
The objective of this observational study is to explore the long-term effects of roprastine given to promote platelet implantation in hematopoietic stem cell hemicongruent transplantation in children with thalassemia.
- Trial name
- NCT07003256
- Testing
- Romiplostim
- Where
- China
- Volunteers
- 16 people
- Sponsor
- Haikou Affiliated Hospital of Central South University Xiangya School of Medicine
Aplastic Anemia
A Study of Avatrombopag in Adults With Aplastic Anemia Who Did Not Respond to, Cannot Receive, or Had Return of Disease After Standard Treatment
This research study is testing a medicine called avatrombopag in adults with aplastic anemia, a rare condition where the bone marrow does not produce enough blood cells.
- Trial name
- NCT07786922
- Testing
- Avatrombopag 20 mg Oral Tablet
- Volunteers
- 26 people
- Sponsor
- Swedish Orphan Biovitrum